Structure of PDB 5lde Chain A Binding Site BS01

Receptor Information
>5lde Chain A (length=221) Species: 1320,868565 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QYKLILNAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVELEVLDPN
SMATYEVLCEVARKLGTDDREVVLFLLNVFIPQPTLAQLIGALRALKEEG
RLTFPLLAECLFRAGRRDLLRDLLHLDPRFLERHLAGTMSYFSPYQLTVL
HVDGELCARDIRSLIFLSKDTIGSSTPQTFLHWVYCMENLDLLGPTDVDA
LMSMLRSLSRVDLQRQVQTLM
Ligand information
>5lde Chain S (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LQVAYHALFQAYDNHIKSSC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lde IKK gamma-Mimetic Peptides Block the Resistance to Apoptosis Associated with Kaposi's Sarcoma-Associated Herpesvirus Infection.
Resolution3.38 Å
Binding residue
(original residue number in PDB)		F153 P154 A157 L173 H174 L175 D176 F179 H183 Y190
Binding residue
(residue number reindexed from 1)		F104 P105 A108 L124 H125 L126 D127 F130 H134 Y141
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006915 apoptotic process
GO:0042981 regulation of apoptotic process
GO:0052150 symbiont-mediated perturbation of host apoptosis
GO:0085033 symbiont-mediated activation of host NF-kappaB cascade
Cellular Component
GO:0005618 cell wall

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lde, PDBe:5lde, PDBj:5lde
PDBsum5lde
PubMed28931678
UniProtF5HEZ4;
P19909|SPG2_STRSG Immunoglobulin G-binding protein G (Gene Name=spg)

[Back to BioLiP]