Structure of PDB 5l9b Chain A Binding Site BS01

Receptor Information
>5l9b Chain A (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPALKLALEYIVPAMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTD
GQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKL
GSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAK
VSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAIT
VWYFDADERAAAKVKYLTGEKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l9b Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		Q239 L240 V241 S242 K244 W258 D277 R281 N293 G294 R295 K297 Y310 H313 V314 D315 P317 R322 R370 W389 F391 R396 K400
Binding residue
(residue number reindexed from 1)		Q52 L53 V54 S55 K57 W71 D90 R94 N106 G107 R108 K110 Y123 H126 V127 D128 P130 R135 R183 W202 F204 R209 K213
Enzymatic activity
Enzyme Commision number 1.14.11.29: hypoxia-inducible factor-proline dioxygenase.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031418 L-ascorbic acid binding

View graph for
Molecular Function
External links
PDB RCSB:5l9b, PDBe:5l9b, PDBj:5l9b
PDBsum5l9b
PubMed27561929
UniProtQ9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)

[Back to BioLiP]