Structure of PDB 5l7k Chain A Binding Site BS01

Receptor Information
>5l7k Chain A (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKK
RFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFD
FHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRL
VMHNKADYSYS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l7k Novel Biochemical and Structural Insights into the Interaction of Myristoylated Cargo with Unc119 Protein and Their Release by Arl2/3.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
F88 V89 R90 F91 I105 R127 F128 V129 Y220
Binding residue
(residue number reindexed from 1)
F31 V32 R33 F34 I48 R51 F52 V53 Y144
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5l7k, PDBe:5l7k, PDBj:5l7k
PDBsum5l7k
PubMed27481943
UniProtQ13432|U119A_HUMAN Protein unc-119 homolog A (Gene Name=UNC119)

[Back to BioLiP]