Structure of PDB 5l3t Chain A Binding Site BS01

Receptor Information
>5l3t Chain A (length=294) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVRPPHILVKTLDYIVDNLLTTLPESEGFLWDRMRSIRQDFTYQNYSGPE
AVDCNERIVRIHLLILHIMVKSNVEFSLQQELEQLHKSLITLSEIYDDVR
SSGGTCPNEAEFRAYALLSKIRDPQYDENIQRLPKHIFQDKLVQMALCFR
RVISNSAYTERGFVKTENCLNFYARFFQLMQSPSLPLLMGFFLQMHLTDI
RFYALRALSHTLNKKHKPIPFIYLENMLLFNNRQEIIEFCNYYSIEIING
DAADLKTLQHYSHKLSETQPLKKTYLTCLERRLQKTTYKGLING
Ligand information
>5l3t Chain F (length=11) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l3t The Sac3 TPR-like region in the Saccharomyces cerevisiae TREX-2 complex is more extensive but independent of the CID region.
Resolution4.927 Å
Binding residue
(original residue number in PDB)		D254 R256 P257 I260
Binding residue
(residue number reindexed from 1)		D1 R3 P4 I7
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0000973 post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006406 mRNA export from nucleus
GO:0006611 protein export from nucleus
GO:0030029 actin filament-based process
GO:0031124 mRNA 3'-end processing
GO:0042274 ribosomal small subunit biogenesis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051028 mRNA transport
GO:0071028 nuclear mRNA surveillance
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0044614 nuclear pore cytoplasmic filaments
GO:0070390 transcription export complex 2

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5l3t, PDBe:5l3t, PDBj:5l3t
PDBsum5l3t
PubMed27422657
UniProtP46674|SAC3_YEAST Nuclear mRNA export protein SAC3 (Gene Name=SAC3)

[Back to BioLiP]