Structure of PDB 5l23 Chain A Binding Site BS01

Receptor Information
>5l23 Chain A (length=58) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIP
VPYVEKYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l23 Crystal structure of the complex between the N-terminal SH3 domain of CrkII and a proline-rich ligand
Resolution1.77 Å
Binding residue
(original residue number in PDB)		F141 E149 D150 P165 E166 Q168 W169 M181 Y186
Binding residue
(residue number reindexed from 1)		F8 E16 D17 P32 E33 Q35 W36 M48 Y53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5l23, PDBe:5l23, PDBj:5l23
PDBsum5l23
PubMed
UniProtQ64010|CRK_MOUSE Adapter molecule crk (Gene Name=Crk)

[Back to BioLiP]