Structure of PDB 5kw6 Chain A Binding Site BS01

Receptor Information
>5kw6 Chain A (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRGSAAQRQGALAIMSRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWD
SVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQP
IIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSATLARDPTT
GKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPA
T
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kw6 Unraveling the mechanism of recognition of the 3' splice site of the adenovirus major late promoter intron by the alternative splicing factor PUF60.
Resolution1.91 Å
Binding residue
(original residue number in PDB)		Y132 F174 R204 P205 S206 N207
Binding residue
(residue number reindexed from 1)		Y19 F61 R91 P92 S93 N94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5kw6, PDBe:5kw6, PDBj:5kw6
PDBsum5kw6
PubMed33253191
UniProtQ9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 (Gene Name=PUF60)

[Back to BioLiP]