Structure of PDB 5ksv Chain A Binding Site BS01

Receptor Information
>5ksv Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLR
QFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLG
QPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISY
LTLLPSAEESYDCKVEHWGLDKPLLKHWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ksv Unraveling the structural basis for the unusually rich association of human leukocyte antigen DQ2.5 with class-II-associated invariant chain peptides.
Resolution2.195 Å
Binding residue
(original residue number in PDB)
Y9 Y22 F51 R52 N62 V65 N69
Binding residue
(residue number reindexed from 1)
Y9 Y23 F52 R53 N62 V65 N69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5ksv, PDBe:5ksv, PDBj:5ksv
PDBsum5ksv
PubMed28364043
UniProtP01909|DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain (Gene Name=HLA-DQA1)

[Back to BioLiP]