Structure of PDB 5ksa Chain A Binding Site BS01

Receptor Information
>5ksa Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWSLPVL
RQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTL
GQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKIS
YLTLLPSAEESYDCKVEHWGLDKPLLKHWEPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ksa Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y9 F52 R53 F58 N62 H68 N69 S72 L73 R76
Binding residue
(residue number reindexed from 1)		Y10 F53 R54 F59 N63 H69 N70 S73 L74 R77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ksa, PDBe:5ksa, PDBj:5ksa
PDBsum5ksa
PubMed27568928
UniProtP01909|DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain (Gene Name=HLA-DQA1)

[Back to BioLiP]