Structure of PDB 5kn9 Chain A Binding Site BS01

Receptor Information
>5kn9 Chain A (length=222) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRYETVIPY
FEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYG
GKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLV
TDDIAKCSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLL
CPVQAYCQAFAEGVAEELPVKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kn9 Structural Basis for the Lesion-scanning Mechanism of the MutY DNA Glycosylase.
Resolution1.93 Å
Binding residue
(original residue number in PDB)		G87 Y88 K163 C164 S165
Binding residue
(residue number reindexed from 1)		G80 Y81 K156 C157 S158
Enzymatic activity
Catalytic site (original residue number in PDB) E43 Y126 N144
Catalytic site (residue number reindexed from 1) E36 Y119 N137
Enzyme Commision number 3.2.2.31: adenine glycosylase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0019104 DNA N-glycosylase activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5kn9, PDBe:5kn9, PDBj:5kn9
PDBsum5kn9
PubMed28130451
UniProtP83847|MUTY_GEOSE Adenine DNA glycosylase (Gene Name=mutY)

[Back to BioLiP]