Structure of PDB 5kmx Chain A Binding Site BS01

Receptor Information
>5kmx Chain A (length=202) Species: 1068625 (Trypanosoma congolense IL3000) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRDDFKEAVNAFNPNPIEKWTGRFNTENASVRRRTLNVPGFKSIPTVYTE
ATLPLNKDVTDGRLTVVVNINTVQPFTRRTPLRVKREKWYTCSSSCHRKH
DEFRNKCISEGGRYTTESSKCRLGEKCGYCKQNVYLATLYLVAGSVGGGM
YRESDKYQSALYPFYDISQGYEPRQPSSVNVRLYSEGDPFIAFQQLTEGR
EE
Ligand information
>5kmx Chain U (length=14) Species: 1068625 (Trypanosoma congolense IL3000) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GAAAAAGGAAAGGG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kmx Structural characterization reveals a novel bilobed architecture for the ectodomains of insect stage expressed Trypanosoma brucei PSSA-2 and Trypanosoma congolense ISA.
Resolution2.452 Å
Binding residue
(original residue number in PDB)		K128 Y224
Binding residue
(residue number reindexed from 1)		K85 Y171
Enzymatic activity
Enzyme Commision number ?
External links