Structure of PDB 5kl4 Chain A Binding Site BS01

Receptor Information
>5kl4 Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSEKPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDH
LKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kl4 Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
Resolution1.783 Å
Binding residue
(original residue number in PDB)		R366 H369 R372 H373 R376 R390 R394 H397 H401 T404 R424 R430
Binding residue
(residue number reindexed from 1)		R19 H22 R25 H26 R29 R43 R47 H50 H54 T57 R77 R83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5kl4, PDBe:5kl4, PDBj:5kl4
PDBsum5kl4
PubMed27596598
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]