Structure of PDB 5kl2 Chain A Binding Site BS01

Receptor Information
>5kl2 Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLK
THTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kl2 Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
Resolution1.692 Å
Binding residue
(original residue number in PDB)		R362 R366 Q369 R372 H373 R376 R390 R394 H397 H401 T404 R424 R430
Binding residue
(residue number reindexed from 1)		R13 R17 Q20 R23 H24 R27 R41 R45 H48 H52 T55 R75 R81
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5kl2, PDBe:5kl2, PDBj:5kl2
PDBsum5kl2
PubMed27596598
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]