Structure of PDB 5kkq Chain A Binding Site BS01

Receptor Information
>5kkq Chain A (length=147) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKL
KRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARF
TQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kkq Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution1.744 Å
Binding residue
(original residue number in PDB)
F351 K367 Y392 K395 Y407 S419 K423 S450
Binding residue
(residue number reindexed from 1)
F35 K51 Y76 K79 Y91 S103 K107 S134
Binding affinityPDBbind-CN: Kd=9nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5kkq, PDBe:5kkq, PDBj:5kkq
PDBsum5kkq
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]