Structure of PDB 5kk1 Chain A Binding Site BS01

Receptor Information
>5kk1 Chain A (length=88) Species: 84600 (Sulfolobus sp. NOB8H2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAE
GYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kk1 Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
Resolution3.38 Å
Binding residue
(original residue number in PDB)
S5 S31 Y41 Q42 I66 Y68
Binding residue
(residue number reindexed from 1)
S1 S27 Y37 Q38 I62 Y64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5kk1, PDBe:5kk1, PDBj:5kk1
PDBsum5kk1
PubMed
UniProtO93706

[Back to BioLiP]