Structure of PDB 5keb Chain A Binding Site BS01

Receptor Information
>5keb Chain A (length=84) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDDLTR
HYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5keb Distinctive Klf4 mutants determine preference for DNA methylation status.
Resolution2.453 Å
Binding residue
(original residue number in PDB)		Y411 K413 H416 R443 R449 K453 R471 H474
Binding residue
(residue number reindexed from 1)		Y12 K14 H17 R44 R50 K54 R72 H75
Binding affinityPDBbind-CN: Kd=0.22uM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5keb, PDBe:5keb, PDBj:5keb
PDBsum5keb
PubMed27596594
UniProtQ60793|KLF4_MOUSE Krueppel-like factor 4 (Gene Name=Klf4)

[Back to BioLiP]