Structure of PDB 5kea Chain A Binding Site BS01

Receptor Information
>5kea Chain A (length=87) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDD
LTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kea Distinctive Klf4 mutants determine preference for DNA methylation status.
Resolution2.458 Å
Binding residue
(original residue number in PDB)		K409 Y411 T412 K413 H416 W439 F441 R443 R449 H450 R471 H474
Binding residue
(residue number reindexed from 1)		K13 Y15 T16 K17 H20 W43 F45 R47 R53 H54 R75 H78
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5kea, PDBe:5kea, PDBj:5kea
PDBsum5kea
PubMed27596594
UniProtQ60793|KLF4_MOUSE Krueppel-like factor 4 (Gene Name=Klf4)

[Back to BioLiP]