Structure of PDB 5ke9 Chain A Binding Site BS01

Receptor Information
>5ke9 Chain A (length=88) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSD
PLTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ke9 Distinctive Klf4 mutants determine preference for DNA methylation status.
Resolution2.336 Å
Binding residue
(original residue number in PDB)		H416 W439 F441 R443 R449 H450 K453 R471 H474
Binding residue
(residue number reindexed from 1)		H21 W44 F46 R48 R54 H55 K58 R76 H79
Binding affinityPDBbind-CN: Kd<3.6nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ke9, PDBe:5ke9, PDBj:5ke9
PDBsum5ke9
PubMed27596594
UniProtQ60793|KLF4_MOUSE Krueppel-like factor 4 (Gene Name=Klf4)

[Back to BioLiP]