Structure of PDB 5k5q Chain A Binding Site BS01

Receptor Information
>5k5q Chain A (length=89) Species: 84600 (Sulfolobus sp. NOB8H2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAE
GYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5q Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
Resolution2.649 Å
Binding residue
(original residue number in PDB)		S31 Y41 Q42 I66 Y68
Binding residue
(residue number reindexed from 1)		S27 Y37 Q38 I62 Y64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5k5q, PDBe:5k5q, PDBj:5k5q
PDBsum5k5q
PubMed26339031
UniProtO93706

[Back to BioLiP]