Structure of PDB 5k5j Chain A Binding Site BS01

Receptor Information
>5k5j Chain A (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMH
ILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAV
FHERYALIQHQKSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5j Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution2.287 Å
Binding residue
(original residue number in PDB)
Y392 K423 R457
Binding residue
(residue number reindexed from 1)
Y17 K48 R82
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5k5j, PDBe:5k5j, PDBj:5k5j
PDBsum5k5j
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]