Structure of PDB 5k5i Chain A Binding Site BS01

Receptor Information
>5k5i Chain A (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHI
LQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVF
HERYALIQHQKSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5i Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution2.19 Å
Binding residue
(original residue number in PDB)
Y392 R457
Binding residue
(residue number reindexed from 1)
Y16 R81
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5k5i, PDBe:5k5i, PDBj:5k5i
PDBsum5k5i
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]