Structure of PDB 5k5h Chain A Binding Site BS01

Receptor Information
>5k5h Chain A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMR
THSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARK
SDLGVHLRKQH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5h Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution3.108 Å
Binding residue
(original residue number in PDB)		Y358 K365 R368 H369 Y386 R389 K393 R396 Q418 T421 H425 K429 R448
Binding residue
(residue number reindexed from 1)		Y9 K16 R19 H20 Y37 R40 K44 R47 Q69 T72 H76 K80 R99
Binding affinityPDBbind-CN: Kd=30nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5k5h, PDBe:5k5h, PDBj:5k5h
PDBsum5k5h
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]