Structure of PDB 5k07 Chain A Binding Site BS01

Receptor Information
>5k07 Chain A (length=57) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHK
LPDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k07 Sequence-Dependent T:G Base Pair Opening in DNA Double Helix Bound by Cren7, a Chromatin Protein Conserved among Crenarchaea
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K24 W26 L28 A29 P30 K31 Y49 R51
Binding residue
(residue number reindexed from 1)		K21 W23 L25 A26 P27 K28 Y46 R48
Binding affinityPDBbind-CN: Kd=32.3uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5k07, PDBe:5k07, PDBj:5k07
PDBsum5k07
PubMed27685992
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]