Structure of PDB 5jwe Chain A Binding Site BS01

Receptor Information
>5jwe Chain A (length=276) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVT
LRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVP
LGKEQNYTCRVYHEGLPEPLTLRWEP
Ligand information
>5jwe Chain P (length=10) Species: 11624 (Lymphocytic choriomeningitis virus (strain Armstrong)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CSANNSHHYI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jwe Crystal structures of H-2Db in complex with the LCMV-derived peptides GP92 and GP392 explain pleiotropic effects of glycosylation on antigen presentation and immunogenicity.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y7 Y45 E63 K66 Q70 W73 V76 S77 N80 L81 Y84 Q97 Y123 T143 K146 W147 S150 A152 H155 Y156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y45 E63 K66 Q70 W73 V76 S77 N80 L81 Y84 Q97 Y123 T143 K146 W147 S150 A152 H155 Y156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5jwe, PDBe:5jwe, PDBj:5jwe
PDBsum5jwe
PubMed29253009
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]