Structure of PDB 5jwd Chain A Binding Site BS01

Receptor Information
>5jwd Chain A (length=258) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPTLRCWAL
GFYPADITLTWMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGL
PEPLTLRW
Ligand information
>5jwd Chain C (length=9) Species: 11624 (Lymphocytic choriomeningitis virus (strain Armstrong)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WLVTNGSYL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jwd Crystal structures of H-2Db in complex with the LCMV-derived peptides GP92 and GP392 explain pleiotropic effects of glycosylation on antigen presentation and immunogenicity.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y7 E9 Y59 R62 E63 K66 Q70 W73 V76 S77 N80 Y84 L95 Q97 T143 K146 W147 S150 H155 Y156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E9 Y59 R62 E63 K66 Q70 W73 V76 S77 N80 Y84 L95 Q97 T143 K146 W147 S150 H155 Y156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5jwd, PDBe:5jwd, PDBj:5jwd
PDBsum5jwd
PubMed29253009
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]