Structure of PDB 5jjv Chain A Binding Site BS01

Receptor Information
>5jjv Chain A (length=353) Species: 85962 (Helicobacter pylori 26695) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKHPLEELKDPTENLLLWIGRFLRYKCTSLSNSQVKDQNKVFECLNELNQ
ACSSSQLEKVCKKARNAGLLGINTYALPLLKFHEYFSKAFNSLKNIDEVM
LAEFLSVYTGGLSLATKKNYRIALLGLFSYIDKQNQDENEKSYIYNITLK
NISGVNQSAGNKLPTHLNNEELEKFLESIDKIEMSAKVRARNRLLIKIIV
FTGMRSNEALQLKIKDFTLENGCYTILIKGKGDKYRAVMLKAFHIESLLK
EWLIERELYPVKNDLLFCNQKGSALTQAYLYKQVERIINFAGLRREKNGA
HMLRHSFATLLYQKRHDLILVQEALGHASLNTSRIYTHFDKQRLEEAASI
WEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jjv Structural snapshots of Xer recombination reveal activation by synaptic complex remodeling and DNA bending.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		K62 R65 N66 L77 S121 A123 T124 N127 K170 S193 V196 R199 N277 Q278 L283 T284 A286 Y287 K290 K305 H309 R312 H313 T340
Binding residue
(residue number reindexed from 1)		K62 R65 N66 L77 S113 A115 T116 N119 K162 S185 V188 R191 N269 Q270 L275 T276 A278 Y279 K282 K297 H301 R304 H305 T332
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0009037 tyrosine-based site-specific recombinase activity
Biological Process
GO:0006310 DNA recombination
GO:0007059 chromosome segregation
GO:0015074 DNA integration
GO:0051301 cell division
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jjv, PDBe:5jjv, PDBj:5jjv
PDBsum5jjv
PubMed28009253
UniProtO25386|XERH_HELPY Tyrosine recombinase XerH (Gene Name=xerH)

[Back to BioLiP]