Structure of PDB 5jhp Chain A Binding Site BS01

Receptor Information
>5jhp Chain A (length=182) Species: 4530 (Oryza sativa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEEKVHAGEWD
EVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDRHDRAKAVDILVKDL
KVFSTFNEELYKEITQLLTLENFRENEQLSKYGDTKSARSIMLIELKKLI
EANPLFREKLVFPTLKASRLRTLINQSANWTD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jhp A D53 repression motif induces oligomerization of TOPLESS corepressors and promotes assembly of a corepressor-nucleosome complex.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		R67 K71 F74 K78 L111
Binding residue
(residue number reindexed from 1)		R66 K70 F73 K77 L110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5jhp, PDBe:5jhp, PDBj:5jhp
PDBsum5jhp
PubMed28630893
UniProtQ5NBT9|TPR1_ORYSJ Protein TPR1 (Gene Name=TPR1)

[Back to BioLiP]