Structure of PDB 5jh0 Chain A Binding Site BS01

Receptor Information
>5jh0 Chain A (length=156) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KASKRTQLRNELIKQGPKRPTSAYFLYLQDHRSQFVKENPTLRPAEISKI
AGEKWQNLEADIKEKYISERKKLYSEYQKAKKEFDEKLPPKKPAGPFIKY
ANEVRSQVFAQHPDKSQLDLMKIIGDKWQSLDQSIKDKYIQEYKKAIQEY
NARYPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jh0 DNA structure directs positioning of the mitochondrial genome packaging protein Abf2p.
Resolution2.18 Å
Binding residue
(original residue number in PDB)
K27 K30 K118 F123 L144 M147 K148 W154 Y169
Binding residue
(residue number reindexed from 1)
K1 K4 K92 F97 L118 M121 K122 W128 Y143
Binding affinityPDBbind-CN: Kd=52.1nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5jh0, PDBe:5jh0, PDBj:5jh0
PDBsum5jh0
PubMed27899643
UniProtQ02486|ABF2_YEAST ARS-binding factor 2, mitochondrial (Gene Name=ABF2)

[Back to BioLiP]