Structure of PDB 5jf0 Chain A Binding Site BS01

Receptor Information
>5jf0 Chain A (length=203) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAIDKLVKASHLIDMNDIIREGNPTLRKVAEEVTFPLSEKEEILGEKMMQ
FLKHSQDPIMAEKLGLRGGVGLAAPQLDISKRIIAVLVPNVEDAQGNPPK
EAYSLQEVMYNPKVVSHSVQDAALSDGEGCLSVDREVPGYVVRHARVTIE
YFDKTGEKHRLKLKGYNSIVVQHEIDHIDGIMFYDRINEKNPFAVKEGLL
ILE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jf0 A unique peptide deformylase platform to rationally design and challenge novel active compounds.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		G69 G70 V71 G72 P90 G130 Y167 H174 E175
Binding residue
(residue number reindexed from 1)		G68 G69 V70 G71 P89 G129 Y166 H173 E174
Enzymatic activity
Catalytic site (original residue number in PDB) G72 Q77 C131 L132 H174 E175 H178
Catalytic site (residue number reindexed from 1) G71 Q76 C130 L131 H173 E174 H177
Enzyme Commision number 3.5.1.88: peptide deformylase.
Gene Ontology
Molecular Function
GO:0016787 hydrolase activity
GO:0042586 peptide deformylase activity
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0018206 peptidyl-methionine modification

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5jf0, PDBe:5jf0, PDBj:5jf0
PDBsum5jf0
PubMed27762275
UniProtQ8E378|DEF_STRA3 Peptide deformylase (Gene Name=def)

[Back to BioLiP]