Structure of PDB 5jeo Chain A Binding Site BS01

Receptor Information
>5jeo Chain A (length=234) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTL
PGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGH
CHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGR
SPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLE
NTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jeo Structural basis for concerted recruitment and activation of IRF-3 by innate immune adaptor proteins.
Resolution1.719 Å
Binding residue
(original residue number in PDB)		R211 Y260 R285 H288 H290 K313 G349 E350 S351 L362
Binding residue
(residue number reindexed from 1)		R23 Y72 R97 H100 H102 K125 G161 E162 S163 L174
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5jeo, PDBe:5jeo, PDBj:5jeo
PDBsum5jeo
PubMed27302953
UniProtQ14653|IRF3_HUMAN Interferon regulatory factor 3 (Gene Name=IRF3)

[Back to BioLiP]