Structure of PDB 5jbt Chain A Binding Site BS01

Receptor Information
>5jbt Chain A (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRL
GEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARV
STISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKA
SYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWK
NRPGVYTKVYNYVDWIKDTIAANS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jbt An Acrobatic Substrate Metamorphosis Reveals a Requirement for Substrate Conformational Dynamics in Trypsin Proteolysis.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		H57 L99 D189 S190 C191 Q192 R193 A195 S214 W215 G216
Binding residue
(residue number reindexed from 1)		H40 L81 D171 S172 C173 Q174 R175 A177 S192 W193 G194
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 R193 D194 A195 G196
Catalytic site (residue number reindexed from 1) H40 D84 Q174 R175 D176 A177 G178
Enzyme Commision number 3.4.21.4: trypsin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5jbt, PDBe:5jbt, PDBj:5jbt
PDBsum5jbt
PubMed27810896
UniProtP35030|TRY3_HUMAN Trypsin-3 (Gene Name=PRSS3)

[Back to BioLiP]