Structure of PDB 5j9s Chain A Binding Site BS01

Receptor Information
>5j9s Chain A (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFW
LHDSFPKPRRVCKEPPYKVEESGYAGFIMPIEVHFKNKEEPRKVCFTYDL
FLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGAHHHHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5j9s ENL links histone acetylation to oncogenic gene expression in acute myeloid leukaemia
Resolution2.702 Å
Binding residue
(original residue number in PDB)		H56 S58 F59 G77 Y78 A79 G80 F81 D103 F105
Binding residue
(residue number reindexed from 1)		H52 S54 F55 G73 Y74 A75 G76 F77 D99 F101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5j9s, PDBe:5j9s, PDBj:5j9s
PDBsum5j9s
PubMed28241141
UniProtQ03111|ENL_HUMAN Protein ENL (Gene Name=MLLT1)

[Back to BioLiP]