Structure of PDB 5j6h Chain A Binding Site BS01

Receptor Information
>5j6h Chain A (length=275) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFETSVSRPGLGEPRFIIVGYVDDTQFVRFDSDAETPRMEPRAP
WMEQEGPEYWERETQRAKGNEQSFHVSLRTLLGYYNQSESGSHTIQWMYG
CKVGSDGRFLRGYLQYAYDGRDYIALNEDLKTWTAADVAAIITRRKWEQA
GAAEYYRAYLEAECVEWLLRYLELGKETLLRTDPPKTHVTHHPGEGDVTL
RCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPL
GKEQNYTCHVYHEGLPEPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5j6h Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y7 E63 R66 N70 S73 F74 S77 Y84 W97 Y99 Y116 T143 W147 Y155 Y156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 R66 N70 S73 F74 S77 Y84 W97 Y99 Y116 T143 W147 Y155 Y156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
Cellular Component
GO:0005615 extracellular space
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j6h, PDBe:5j6h, PDBj:5j6h
PDBsum5j6h
PubMed27385590
UniProtP01898|HA10_MOUSE H-2 class I histocompatibility antigen, Q10 alpha chain (Gene Name=H2-Q10)

[Back to BioLiP]