Structure of PDB 5j3q Chain A Binding Site BS01

Receptor Information
>5j3q Chain A (length=125) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEG
TFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQH
VVGLWMFDPNDMSRIFNIVKESLLR
Ligand information
>5j3q Chain B (length=14) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSPAASNLPIPTFL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5j3q Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
Resolution1.87 Å
Binding residue
(original residue number in PDB)		Y36 F38 W45 K47 V90 Y93 R97 V103 W107 F109
Binding residue
(residue number reindexed from 1)		Y34 F36 W43 K45 V88 Y91 R95 V101 W105 F107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0170008 mRNA phosphatase activator activity
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006397 mRNA processing
GO:0043085 positive regulation of catalytic activity
GO:0110156 mRNA methylguanosine-cap decapping
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule
GO:0098745 RNA decapping complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j3q, PDBe:5j3q, PDBj:5j3q
PDBsum5j3q
PubMed27183195
UniProtQ9P805|DCP1_SCHPO mRNA-decapping enzyme subunit 1 (Gene Name=dcp1)

[Back to BioLiP]