Structure of PDB 5j2y Chain A Binding Site BS01

Receptor Information

>5j2y Chain A (length=70) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TQPQNMAFRAKATRTARRESQETFWSRFGISQSCGSRFENGENLPFPIYL
LLHFYIEGQITDRQLADLRG

Ligand information

>5j2y Chain F (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaaattatgaaatttgcataaattc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5j2y Molecular insight into the regulatory mechanism of the quorum-sensing repressor RsaL in Pseudomonas aeruginosa
Resolution	2.4 Å
Binding residue (original residue number in PDB)	S26 Q27 Q38 S39 S42 R43 N46
Binding residue (residue number reindexed from 1)	S20 Q21 Q32 S33 S36 R37 N40

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:5j2y, PDBe:5j2y, PDBj:5j2y
PDBsum	5j2y
PubMed	27924027
UniProt	Q9X7H4

[Back to BioLiP]