Structure of PDB 5ixf Chain A Binding Site BS01

Receptor Information
>5ixf Chain A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENH
RGIGLFPSDFVTTNLNIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ixf NMR Reveals the Interplay among the AMSH SH3 Binding Motif, STAM2, and Lys63-Linked Diubiquitin.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y218 D219 E221 E224 D240 S242 A244 N245 W246 P259 D261 F262
Binding residue
(residue number reindexed from 1)		Y16 D17 E19 E22 D38 S40 A42 N43 W44 P57 D59 F60
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ixf, PDBe:5ixf, PDBj:5ixf
PDBsum5ixf
PubMed27725184
UniProtO75886|STAM2_HUMAN Signal transducing adapter molecule 2 (Gene Name=STAM2)

[Back to BioLiP]