Structure of PDB 5ivn Chain A Binding Site BS01

Receptor Information
>5ivn Chain A (length=121) Species: 30538 (Vicugna pacos) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVESGGGLVQPGGSLTLSCTASGFTLDHYDIGWFRQAPGKEREGVSCI
NNSDDDTYYADSVKGRFTIFMNNAKDTVYLQMNSLKPEDTAIYYCAEARG
CKRGRYEYDFWGQGTQVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ivn Peptides in headlock - a novel high-affinity and versatile peptide-binding nanobody for proteomics and microscopy.
Resolution1.0 Å
Binding residue
(original residue number in PDB)		F37 E44 R45 E46 G47 S49 C50 Y59 Y60 C102 K103 R104 G105 R106 Y107 Y109 D110 F111 W112 S122
Binding residue
(residue number reindexed from 1)		F36 E43 R44 E45 G46 S48 C49 Y58 Y59 C101 K102 R103 G104 R105 Y106 Y108 D109 F110 W111 S121
External links