Structure of PDB 5ith Chain A Binding Site BS01

Receptor Information
>5ith Chain A (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFV
SFFNKWDAENAIQQMGGQWLGGRQIRTNWA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ith TIA-1 RRM23 binding and recognition of target oligonucleotides.
Resolution2.31 Å
Binding residue
(original residue number in PDB)		F98 D101 R125 K136 Y138 F140 R167 N169 A171
Binding residue
(residue number reindexed from 1)		F7 D10 R34 K45 Y47 F49 R76 N78 A80
Binding affinityPDBbind-CN: Kd=0.03uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5ith, PDBe:5ith, PDBj:5ith
PDBsum5ith
PubMed28184449
UniProtP31483|TIA1_HUMAN Cytotoxic granule associated RNA binding protein TIA1 (Gene Name=TIA1)

[Back to BioLiP]