Structure of PDB 5iok Chain A Binding Site BS01

Receptor Information
>5iok Chain A (length=142) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKE
IPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEK
AGERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5iok The Taf14 YEATS domain is a reader of histone crotonylation.
Resolution2.22 Å
Binding residue
(original residue number in PDB)		F27 H59 T61 F62 G80 W81 G82 G83 D104 F107 L108
Binding residue
(residue number reindexed from 1)		F32 H64 T66 F67 G85 W86 G87 G88 D109 F112 L113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5iok, PDBe:5iok, PDBj:5iok
PDBsum5iok
PubMed27089029
UniProtP35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 (Gene Name=TAF14)

[Back to BioLiP]