Structure of PDB 5ii0 Chain A Binding Site BS01

Receptor Information
>5ii0 Chain A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGV
LSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFT
Ligand information
>5ii0 Chain D (length=12) Species: 8017 (Oncorhynchus gorbuscha) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TYPRTNTGSGTP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ii0 Type II Turn of Receptor-bound Salmon Calcitonin Revealed by X-ray Crystallography.
Resolution2.097 Å
Binding residue
(original residue number in PDB)		D77 W79 F99 P100 D101 F102 H121 E123 W128 S129 Y131 N135
Binding residue
(residue number reindexed from 1)		D38 W40 F60 P61 D62 F63 H82 E84 W89 S90 Y92 N96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004948 calcitonin receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ii0, PDBe:5ii0, PDBj:5ii0
PDBsum5ii0
PubMed27189946
UniProtP30988|CALCR_HUMAN Calcitonin receptor (Gene Name=CALCR)

[Back to BioLiP]