Structure of PDB 5ih2 Chain A Binding Site BS01

Receptor Information
>5ih2 Chain A (length=58) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIP
VPYVEKYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ih2 Binding Mechanism of the N-Terminal SH3 Domain of CrkII and Proline-Rich Motifs in cAbl.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		F141 D142 D147 E149 D150 E166 Q168 W169 P185 Y186
Binding residue
(residue number reindexed from 1)		F8 D9 D14 E16 D17 E33 Q35 W36 P52 Y53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ih2, PDBe:5ih2, PDBj:5ih2
PDBsum5ih2
PubMed27332121
UniProtQ64010|CRK_MOUSE Adapter molecule crk (Gene Name=Crk)

[Back to BioLiP]