Structure of PDB 5i7z Chain A Binding Site BS01

Receptor Information
>5i7z Chain A (length=96) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAE
STGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5i7z Binding of Crumbs to the Par-6 CRIB-PDZ Module Is Regulated by Cdc42.
Resolution1.801 Å
Binding residue
(original residue number in PDB)		P171 L172 F174 Y175 I176 S198 R199 D232 T235
Binding residue
(residue number reindexed from 1)		P14 L15 F17 Y18 I19 S41 R42 D75 T78
Enzymatic activity
Enzyme Commision number ?
External links