Structure of PDB 5i50 Chain A Binding Site BS01

Receptor Information
>5i50 Chain A (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MATEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILK
KATAYILSVQAETQKLISEIDLLRKQNEQLKHKLEQLRNSCA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5i50 OmoMYC blunts promoter invasion by oncogenic MYC to inhibit gene expression characteristic of MYC-dependent tumors.
Resolution2.701 Å
Binding residue
(original residue number in PDB)		E16 R19
Binding residue
(residue number reindexed from 1)		E16 R19
Binding affinityPDBbind-CN: Kd=391nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5i50, PDBe:5i50, PDBj:5i50
PDBsum5i50
PubMed27748763
UniProtP01106|MYC_HUMAN Myc proto-oncogene protein (Gene Name=MYC)

[Back to BioLiP]