Structure of PDB 5i22 Chain A Binding Site BS01

Receptor Information
>5i22 Chain A (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGW
LMGVKESDWNQHKELEKCRGVFPENFTERVP
Ligand information
>5i22 Chain B (length=17) Species: 37124 (Chikungunya virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
STVPVAPPRRRRGRNLT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5i22 Structural Basis of the High Affinity Interaction between the Alphavirus Nonstructural Protein-3 (nsP3) and the SH3 Domain of Amphiphysin-2.
ResolutionN/A
Binding residue
(original residue number in PDB)		H529 D535 E538 E557 D559 G561 W562 P585 N587 F588
Binding residue
(residue number reindexed from 1)		H17 D23 E26 E45 D47 G49 W50 P73 N75 F76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5i22, PDBe:5i22, PDBj:5i22
PDBsum5i22
PubMed27268056
UniProtO00499|BIN1_HUMAN Myc box-dependent-interacting protein 1 (Gene Name=BIN1)

[Back to BioLiP]