Structure of PDB 5hyp Chain A Binding Site BS01

Receptor Information
>5hyp Chain A (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCN
SDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLI
GSTTSRCEVQDRGVGWSHPLPQCEI
Ligand information
>5hyp Chain B (length=29) Species: 1314 (Streptococcus pyogenes) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADKLADAYNTLLTEHEKLRDEYYTLIDAK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hyp Conserved patterns hidden within group A Streptococcus M protein hypervariability recognize human C4b-binding protein.
Resolution3.024 Å
Binding residue
(original residue number in PDB)		V38 R39 S40 H41 S42 K63 C65 R66 H67 E70 L82
Binding residue
(residue number reindexed from 1)		V39 R40 S41 H42 S43 K64 C66 R67 H68 E71 L83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5hyp, PDBe:5hyp, PDBj:5hyp
PDBsum5hyp
PubMed27595425
UniProtP04003|C4BPA_HUMAN C4b-binding protein alpha chain (Gene Name=C4BPA)

[Back to BioLiP]