Structure of PDB 5hvz Chain A Binding Site BS01

Receptor Information
>5hvz Chain A (length=50) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK
Ligand information
>5hvz Chain C (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TVILEYAHRLSQDILCDALQQWA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hvz Structure of smAKAP and its regulation by PKA-mediated phosphorylation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
C16 V20 Q26 K30 I33
Binding residue
(residue number reindexed from 1)
C5 V9 Q15 K19 I22
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5hvz, PDBe:5hvz, PDBj:5hvz
PDBsum5hvz
PubMed27028580
UniProtP00514|KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit (Gene Name=PRKAR1A)

[Back to BioLiP]