Structure of PDB 5hu3 Chain A Binding Site BS01

Receptor Information

>5hu3 Chain A (length=266) Species: 7227 (Drosophila melanogaster)

CTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQ
KLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVARE
FYSEADASHCIQQILESVNHCHQNGVVHRNLKPENLLLASKAKGAAVKLA
DFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYI
LLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVN
PNKRITAAEALKHPWI

Ligand information

>5hu3 Chain B (length=16) Species: 7227 (Drosophila melanogaster)

ATLARQDTIDEGGEVD

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5hu3 The Interaction between the Drosophila EAG Potassium Channel and the Protein Kinase CaMKII Involves an Extensive Interface at the Active Site of the Kinase.
• Resolution: 1.885 Å
• Binding residue (original residue number in PDB): G23 A24 R53 K57 E97 F99 E100 I102 N136 K138 E140 D157 L160 W171 F172 G173 F174 A175 G176 T177 G179 P212 W215
• Binding residue (residue number reindexed from 1): G17 A18 R47 K51 E91 F93 E94 I96 N130 K132 E134 D151 L154 W165 F166 G167 F168 A169 G170 T171 G173 P206 W209

Enzymatic activity

• Catalytic site (original residue number in PDB): N136 K138 N141 D157 T177
• Catalytic site (residue number reindexed from 1): N130 K132 N135 D151 T171
• Enzyme Commision number: 2.7.11.17: calcium/calmodulin-dependent protein kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:5hu3, PDBe:5hu3, PDBj:5hu3
• PDBsum: 5hu3
• PubMed: 30381148
• UniProt: Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain (Gene Name=CaMKII)