Structure of PDB 5hsp Chain A Binding Site BS01

Receptor Information
>5hsp Chain A (length=80) Species: 55518 (Magnetospirillum gryphiswaldense) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMEAVQNRIVEAAERVPGVRGVIHLRARYVGQDIWADLIIGVDPENTVE
QAHEICEAVQAAVCGKIRRIESLHVSAEAR
Ligand information
>5hsp Chain D (length=8) Species: 55518 (Magnetospirillum gryphiswaldense) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SFDEVMLS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hsp Disease-Homologous Mutation in the Cation Diffusion Facilitator Protein MamM Causes Single-Domain Structural Loss and Signifies Its Importance.
Resolution1.79 Å
Binding residue
(original residue number in PDB)		R238 R240 W247 A248 H285
Binding residue
(residue number reindexed from 1)		R27 R29 W36 A37 H74
Enzymatic activity
Catalytic site (original residue number in PDB) R238 Q244
Catalytic site (residue number reindexed from 1) R27 Q33
Enzyme Commision number ?
External links
PDB RCSB:5hsp, PDBe:5hsp, PDBj:5hsp
PDBsum5hsp
PubMed27550551
UniProtV6F235|MAMM_MAGGM Magnetosome protein MamM (Gene Name=mamM)

[Back to BioLiP]