Structure of PDB 5hr7 Chain A Binding Site BS01

Receptor Information
>5hr7 Chain A (length=360) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKINLLDLNRQQMREFFKDLGEKPFRADQVMKWMYHYCCDNFDEMTDINK
VLRGKLKEVAEIRAPEVVEEQRSSDGTIKWAIAVGDQRVETVYIPEDDRA
TLAVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIVGAAKVT
GQRPITNVVMMGMGEPLLNLNNVVPAMEIMLDDFGFGLSKRRVTLSTSGV
VPALDKLGDMIDVALAISLHAPNDEIRDEIVPINKKYNIETFLAAVRRYL
EKSNANQGRVTIEYVMLDHVNDGTEHAHQLAELLKDTPCKINLIPWNPFP
GAPYGRSSNSRIDRFSKVLMSYGFTTIVRKTRGDDIDAACGQLAGDVIDR
TKRTLRKRMQ
Ligand information
>5hr7 Chain D (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccccuucgucuagaggcccaggacaccgcccuuucacggcgguaacaggg
guucgaauccccuaggggac
<<<<<..<<<<.........>>>>.<<<<<.......>>>>>....<<<<
<.......>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hr7 Crystallographic capture of a radical S-adenosylmethionine enzyme in the act of modifying tRNA.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		K38 R41 K47 N64 I109 R114 T116 N172 V174 D198 G202 S204 K205 R206 R207 T209 N269 Q272 R274 T276 K305 N307 M335 G338 T340 I342 R344 R347 A354 C355
Binding residue
(residue number reindexed from 1)		K23 R26 K32 N49 I94 R99 T101 N157 V159 D183 G187 S189 K190 R191 R192 T194 N254 Q257 R259 T261 K290 N292 M320 G323 T325 I327 R329 R332 A339 C340
Enzymatic activity
Enzyme Commision number 2.1.1.192: 23S rRNA (adenine(2503)-C(2))-methyltransferase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0002935 tRNA (adenine(37)-C2)-methyltransferase activity
GO:0003824 catalytic activity
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008173 RNA methyltransferase activity
GO:0019843 rRNA binding
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
GO:0070040 rRNA (adenine(2503)-C2-)-methyltransferase activity
Biological Process
GO:0006364 rRNA processing
GO:0008033 tRNA processing
GO:0030488 tRNA methylation
GO:0032259 methylation
GO:0046677 response to antibiotic
GO:0070475 rRNA base methylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hr7, PDBe:5hr7, PDBj:5hr7
PDBsum5hr7
PubMed27081063
UniProtP36979|RLMN_ECOLI Dual-specificity RNA methyltransferase RlmN (Gene Name=rlmN)

[Back to BioLiP]