Structure of PDB 5hr6 Chain A Binding Site BS01

Receptor Information
>5hr6 Chain A (length=354) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
INLLDLNRQQMREFFKDLGEKPFRADQVMKWMYHYCCDNFDEMTDINKVL
RGKLKEVAEIRAPEVVEEQRSSDGTIKWAIAVGDQRVETVYIPEDDRATL
AVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIVGAAKVTGQ
RPITNVVMMGMGEPLLNLNNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVP
ALDKLGDMIDVALAISLHAPNDEIRDEIVPINKKYNIETFLAAVRRYLEK
SNANQGRVTIEYVMLDHVNDGTEHAHQLAELLKDTPCKINLIPWNPFPGA
PYGRSSNSRIDRFSKVLMSYGFTTIVRKTRGDDIDAACGQLAGDVIDRTK
RTLR
Ligand information
>5hr6 Chain C (length=68) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccccuucgucuagaggcccaggacaccgcccuuucacggcgguaacaggg
guucgaauccccuagggg
<<<<<..<<<<.........>>>>.<<<<<.......>>>>>....<<<<
<.......>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hr6 Crystallographic capture of a radical S-adenosylmethionine enzyme in the act of modifying tRNA.
Resolution2.88 Å
Binding residue
(original residue number in PDB)		R41 K47 D62 N64 I109 R114 T116 K163 R168 N172 V174 D198 F199 G202 S204 K205 R206 R207 L230 N269 Q272 R274 T276 K305 N307 M335 G338 T340 I342 R344 A354 C355
Binding residue
(residue number reindexed from 1)		R24 K30 D45 N47 I92 R97 T99 K146 R151 N155 V157 D181 F182 G185 S187 K188 R189 R190 L213 N252 Q255 R257 T259 K288 N290 M318 G321 T323 I325 R327 A337 C338
Enzymatic activity
Catalytic site (original residue number in PDB) E105 A118 C125 C129 C132 C355
Catalytic site (residue number reindexed from 1) E88 A101 C108 C112 C115 C338
Enzyme Commision number 2.1.1.192: 23S rRNA (adenine(2503)-C(2))-methyltransferase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0002935 tRNA (adenine(37)-C2)-methyltransferase activity
GO:0003824 catalytic activity
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008173 RNA methyltransferase activity
GO:0019843 rRNA binding
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
GO:0070040 rRNA (adenine(2503)-C2-)-methyltransferase activity
Biological Process
GO:0006364 rRNA processing
GO:0008033 tRNA processing
GO:0030488 tRNA methylation
GO:0032259 methylation
GO:0046677 response to antibiotic
GO:0070475 rRNA base methylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hr6, PDBe:5hr6, PDBj:5hr6
PDBsum5hr6
PubMed27081063
UniProtP36979|RLMN_ECOLI Dual-specificity RNA methyltransferase RlmN (Gene Name=rlmN)

[Back to BioLiP]