Structure of PDB 5hp4 Chain A Binding Site BS01

Receptor Information

>5hp4 Chain A (length=272) Species: 10726 (Tequintavirus T5)

RNLMIVDGTNLGFRFKHNNSKKPFASSYVSTIQSLAKSYSARTTIVLGDK
GKSVFRLEHLPEYKGNRDEKYAQRTEEEKALDEQFFEYLKDAFELCKTTF
PTFTIRGVEADDMAAYIVKLIGHLYDHVWLISTDGKWDTLLTDKVSRFSF
TTRREYHLRDMYEHHNVDDVEQFISLKAIMGDLGDNIRGVEGIGAKRGYN
IIREFGNVLDIIDQLPLPGKQKYIQNLNASEELLFRNLILVDLPTYCVDA
IAAVGQDVLDKFTKDILEIAEQ

Ligand information

>5hp4 Chain X (length=17)

gatctatatgccatcgg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5hp4 Direct observation of DNA threading in flap endonuclease complexes.
• Resolution: 1.86 Å
• Binding residue (original residue number in PDB): F32 R33 K35 H36 N37 N38 S39 E96 E97 L100 F167 R172 E210 G211 G213 K215 R216
• Binding residue (residue number reindexed from 1): F13 R14 K16 H17 N18 N19 S20 E77 E78 L81 F148 R153 E191 G192 G194 K196 R197

Enzymatic activity

• Enzyme Commision number: 3.1.11.-
  3.1.11.3: exodeoxyribonuclease (lambda-induced).

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0004519 endonuclease activity
• GO:0004527 exonuclease activity
• GO:0004529 DNA exonuclease activity
• GO:0008409 5'-3' exonuclease activity
• GO:0016788 hydrolase activity, acting on ester bonds
• GO:0017108 5'-flap endonuclease activity
• GO:0035312 5'-3' DNA exonuclease activity
• GO:0046872 metal ion binding
• GO:0048256 flap endonuclease activity
• GO:0051908 double-stranded DNA 5'-3' DNA exonuclease activity
• GO:1990238 double-stranded DNA endonuclease activity

Biological Process

• GO:0006260 DNA replication
• GO:0019086 late viral transcription
• GO:0033567 DNA replication, Okazaki fragment processing
• GO:0039693 viral DNA genome replication

Cellular Component

• GO:0019034 viral replication complex

External links

• PDB: RCSB:5hp4, PDBe:5hp4, PDBj:5hp4
• PDBsum: 5hp4
• PubMed: 27273516
• UniProt: P06229|FEN_BPT5 Flap endonuclease (Gene Name=D15)